PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA08g02860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YA
Protein Properties Length: 185aa    MW: 20891.3 Da    PI: 9.7802
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA08g02860genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.96.1e-3248102358
   CBFB_NFYA   3 plYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                 p+YVNaKQy++IlkRRq Rakle+++kl  k rkpylh+SRh+hA+ R+RgsgGrF
  CA08g02860  48 PIYVNAKQYNAILKRRQVRAKLEAQNKL-VKDRKPYLHDSRHRHAMERARGSGGRF 102
                 9***************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005219.1E-3644105IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.72245105IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.5E-244870IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.3E-2848102IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068605070IPR018362CCAAT-binding factor, conserved site
PRINTSPR006166.5E-2479102IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
ACVSYPWADS YFGRLISTYE SNAINYPQRA GVTSTRVALP LDCTESLPIY VNAKQYNAIL  60
KRRQVRAKLE AQNKLVKDRK PYLHDSRHRH AMERARGSGG RFLNTKNMQQ SNPSSPKHDK  120
NIFKQQAGAM VQHSESGSWG TSTQSGSDVT SIFNDDDMFR QPEFRVSGFP FHMQEAEDFM  180
HVGT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-2348107463NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ8654091e-178KJ865409.1 Capsicum annuum cultivar CMS line FS4401 mitochondrion, complete genome.
GenBankKJ8654101e-178KJ865410.1 Capsicum annuum cultivar Jeju mitochondrion, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016537697.11e-139PREDICTED: nuclear transcription factor Y subunit A-3-like
TrEMBLA0A075VW311e-118A0A075VW31_CAPAN; Uncharacterized protein
TrEMBLA0A0V0I7061e-118A0A0V0I706_SOLCH; Putative nuclear transcription factor Y subunit A-8-like
STRINGSolyc08g062210.2.11e-117(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48002027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.17e-41nuclear factor Y, subunit A6